I am apparently a bot. :(
Beep Boop!
(I've let the page sit for a minute or so, and it hasn't concluded that I am not a bot yet, but also, I'm aware I look weird - Firefox, with Javascript JIT disabled, with no GPU acceleration)
I don't know what it's using on the backend, but it doesn't seem to pass for me, and doesn't give me the usual option to pick a baby chicken from a baby duck to prove I'm human.
Console logs that look possibly interesting:
> WEBGL_debug_renderer_info is deprecated in Firefox and will be removed. Please use RENDERER. v1:1:102781
> Turnstile Widget seem to have crashed: 9icuj api.js:1:17810
> Uncaught TurnstileError: [Cloudflare Turnstile] Error: 300030. > https://urlshortenersaresoyesterdaytrythisamazingsuperlongur... B2SIiwBB.js:9
sigh
I don't have WebGL support, so I can't use a URL lengthener, because the bot checker appears to crash shortly after. Someone stop this timeline, I want to get off.
Also wasn't able to use it here, after unblocking the third-party requests to CloudFlare for this site.
This isn't the first time CloudFlare blocks me, but usually it's a CloudFlare page shown before the actual site's page renders.
Internet Service Denier
Same boat, the attempt at bot detection prevents the page from working at all for me.
It just turns URLs into this
urlshortenersaresoyesterdaytrythisamazingsuperlongurlexpander.site/inccrimsoncrawdadbarbadosmandaringratianaplokoon982helpfulbluegiraffenicaraguabelarusianchickielobotjuniorreddormouseunitedstateschhattisgarhirosalindeyodadistantambertunavaticancitydeccanlisettedexterjettsterrunningamaranthbadgeriranturkmenellettericoli271mixedscarleterminediegogarciadutchmabeldudboltworldwidescarletsquirrelgermanyswedishdarceyanakinskywalkeroriginalcoffeetigermontenegrogermanshirleeslymoorevoluminousgreenharrierniuekhmernataleewilhufftarkinmagnificentwhiteguineafowlgreenlandczechfedericafinisvalorum998uniquecoralcranemalaysiafrenchcamilejektonoporkinsconsistentblackgeckocubaxiangdorolisationmedoncheapblackrattlesnakestkittsnevisawadhilonnieyodapleasedvioletcephalopodmoldovaenglishdulcidormthaithaithaigeneticchocolatecaniddiegogarciajavaneseursalationmedondirectlavendercockroachbangladeshkurdishlaurenetarffuldevotedorangemosquitogreecesundaneseannmariebiggsdarklighterpuzzledroseladybugpakistanxhosailysadarthvaderlinguisticorangemackerellibyaukrainianaleecejabbadesilijictiuretastyteallungfishsouthafricagreekhermionegasganoenthusiasticredemugibraltarbalochioliycordpogglethelesserpogglethelesserpogglethelessermedievalvioletgalliformlesothokonkanimarshawattamborviciousbronzemonkeyswedenbelarusianginniferchewbacca712obedienttealplatypusmaldivesromanianjamieniennunb320visibleemeraldopossumazerbaijanmalagasysissiesaeseetiinripescarletswifttristandacunhailocanomellaaylasecura423formidablegreenguanacoswazilandkazakhcorabelleslymooreholyivoryhippopotamuscookislandsmalagasyelonoregregartyphopetiteaquamarinepeacockalgeriasinhalabarbrapadmamidalaoutstandingoutstandingoutstandingnativeamaranthaardwolfbruneivietnamesegillanlandocalrissian619gangangannetgreenlandfowlecuadormalagasyestrellitabibfortunashakysapphirecanideritreasylhetielsayaraelpoof923funpeachgayalindiasinhalarhetahansolovisibletealparrotfishlaoskoreandaniellamasameddaintacttealwoodpeckerswazilanddeccandaveenroostarpalstopcopperperchphilippinesminansticeyodaquintessentiallimeheronfrenchguianaakanronnidarthvaderneutraltancaribouunitedstateszulunathaliequarshpanakaserbiaserbiaserbiacruelaquashrewchristmasislandmaithilicherinsanhillsecurecoffeehummingbirdguadeloupeakansarajanewattamborracialtancaterpillarcomorosxhosacorinnecord487resultingrednarwhalpitcairnislandsrussiancatidookugrossindigodovepanamahindifaydrajarjarbinksplannedvioletrabbitnetherlandsspanishalissadarthmaulfranticscarlettarsiermontserratsylhetijudithamonmothmapatientplumgorillairelandmarathichristianzamwesellrareturquoisebasiliskarubasaraikisuehansolo740governingredbatargentinamossialyseniennunbvagueamethystwaspfinlandpunjabicherrieethkoth601diplomatictansilverfishtokelaugankelliedormmandarinmandarinmandarinrelaxedharlequinfroggrenadaukrainianalviniawattamborattractiveblackprawnisraelquechuasherriemacewinduoldcyansquirrelaustraliajapanesemerridiec3pocheerfulamberparrotslovakiauyghurstefaniadarthvadermixedcopperbasilisktanzaniateluguzarahlamasuvocationalwhitemammalliberiaurdujemimabiggsdarklighterimportantazurechimpanzeeseychellesharyanvileeseplokooncausalyellowbarracudamaltahmonggertrudchewbaccaagreeableivoryclamguatemalatamilpapagenaslymooresmoggyvioletarmadilloascensionislandchewaconstancefinisvalorumserioustealthrushfrenchguianaigboclaudinaraymusantilles929sensiblefuchsiacapybaraelsalvadorbalochimirabellapadmamidalaslimyharlequinbuzzardjapansaraikimildridr4p17107dailydailydailymanypurplechameleonnigeriahindihillarychewbaccasingleturquoisebarnaclemartiniqueburmesefarandbobafettcooltealperchsouthgeorgiasouthsandwichislandsmarwaritiertzadexterjettstercapitalistmagentaunicornunitednationssylhetilannyroostarpalsamazingazurecrayfishmaldivesmandarinstormynutegunrayretiredbronzehorsecubajapanesecaroyodacolonialgreenboobystvincentgrenadinessindhisapphirekiadimundiromanticamethystplanariancameroonrussiankaritaluminaraunduli650remarkableapricotpigeonrunionchhattisgarhilelawicketsystriwarrickslipperywhitemolealbaniamadureseednawattambor239
I get that.
And I have friends who would appreciate such things. Just, ideally, with something that absurd going to as short a site as possible. My gripe is that my browser is apparently too-bot-like for something serving a tiny number of requests.
Same for me, with the most generic Chrome-on-Android browser config ever.
It generated a link too long to send over discord, even with nitro (over 4000 characters). That’s hysterical.
I like the concept. A similar idea that is no longer on the web was “shady url”. It would make links that looked like http:// shadyurl.com/nader-for-president.exe
That's hilarious.
The partner project to shadyurl.com was hugeurl.com, which is exactly the same concept as here. hugeurl.com seems to have gone down.
This is great but it's stuck checking if I'm a bot... i get this in the console: ``` auto/:1 The resource https://challenges.cloudflare.com/cdn-cgi/challenge-platform... was preloaded using link preload but not used within a few seconds from the window's load event. Please make sure it has an appropriate `as` value and it is preloaded intentionally. ```
> it's stuck checking if I'm a bot
Man I am seeing this _everywhere_ now. If you don’t have a clean residential US IP half the internet doesn’t work.
Fun site, I found an Easter egg:
https://urlshortenersaresoyesterdaytrythisamazingsuperlongur...
This reminded me of a backend-less filesharing site I once made
After "checking my browser" I try to put in the URL I want to shorten, I click the button, and nothing happens. The URL is hardfault.life, for what it's worth.
Well you tried to shorten it, of course it doesn't work!
It seems to need the scheme portion of the URL, not just the authority.
Yeah, not working for me. The button says "Checking if you're a bot..." and nothing happening. Console shows a warning regarding "The resource at “https://challenges.cloudflare.com/..."
this is great, my succinct little domain that's 6 characters long including TLD was turned into 4000 characters, awesome!
Thanks! This helped make my cloud run url even longer.
This is pure awesomeness. You gotta be an OG to appreciate maybe.
Your bot checker needs some UX help.
Why .site?
urlshortenersaresoyesterdaytrythisamazingsuperlongurlexpander.com is still available
.site is longer
The more likely reason is that .site was cheaper.
Two change suggestions:
- add a donation button and buy a dedi from it - turn off the bot detection
thank me later ig
How are you going to make sure it handles the scale though?
Apparently, by making the bot checker reject most users so that the total number stays small.
The challenge with scaling a url _shortener_ is that multiple urls might end up with the same short url. That presents a scaling challenge where you have to deliberately design a coordination framework across your set of machines, which introduces coordination, a DB, prefixes, and all your favorite answers to the interview question de-jour of the late 2010s.
With a URL _lengthener_ though, you don't need it at all. The sheer amount of possible outcomes means that the odds of ever getting two of the same is infinitesimally tiny.
But how are they going to handle the scale of the URLs, like, emotionally?
That's a good point, if I ever get that interview question I will push back and say we should build an URL lengthener instead.
With a lengthener, you can make it completely deterministic with zero collisions, so you don't even have to store any state
Yeah, you could just have a lookup table that's ASCII characters to "long phrases," and encode the URL that way. Have a bunch of nonsense phrases per character and select them randomly, but as long as the lengthened URL fully encodes the destination URL, there's really no scaling problems to be had. You could even do the whole thing in client-side Javascript if you went that route, purely static site.
Yeah because in theory you could just append the same gibberish string to all the URLs and technically the URL will have been lengthened. Technically you are already lengthening the URL by adding it on top of your domain. Maybe you can base64 it to lengthen it even a bit more and hide the obvious fact that you just added it as a path on top of your domain.
Or you could encode each character with a word.
Love the design!
theofficialabsolutelongestdomainnameregisteredontheworldwideweb.international finally has a worthy opponent.